PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00005690.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LBD
Protein Properties Length: 176aa    MW: 19978.4 Da    PI: 7.57
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00005690.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260111.46.6e-3510104195
                          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgv 79 
                                     aCa+Ck++r+kC ++C lapyfpa++ ++f+n+hklFG+sn++k+++ +++++r++a++s++ e++a+ +d v+G++g+
  FANhyb_rscf00005690.1.g00001.1  10 ACASCKHQRKKCDSNCELAPYFPASKYNEFQNAHKLFGVSNIVKIMSWIEPHQRQAAADSILIEGNAWKNDHVHGCYGL 88 
                                     7****************************************************************************** PP

                          DUF260  80 ilklqqqleqlkaela 95 
                                     i++l  q ++l  +++
  FANhyb_rscf00005690.1.g00001.1  89 IKHLAAQPDELMGDVK 104
                                     *******999877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.0459110IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-3310105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
ESSPSPVNHA CASCKHQRKK CDSNCELAPY FPASKYNEFQ NAHKLFGVSN IVKIMSWIEP  60
HQRQAAADSI LIEGNAWKND HVHGCYGLIK HLAAQPDELM GDVKVFERGH NYWSNLVGTA  120
DEERSFDMEL RDEDGNPSTS FNGQAAGESR RLNNAWSLWT KKKLQKMRLL AWNIYG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011460121.16e-92PREDICTED: LOB domain-containing protein 9-like
TrEMBLM5VSQ03e-42M5VSQ0_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144321117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.13e-29LOB domain-containing protein 22